Description
Overview
| Product name | EN2 Rabbit pAb |
|---|---|
| Catalog No. | A17480 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the ‘engrailed’ (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.
Immunogen information
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-333 of human EN2 (NP_001418.2). |
|---|---|
| Sequence | AFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE |
| Gene ID | |
| Swiss Prot | |
| Synonyms | EN2 |
| Calculated MW | 34kDa |
| Observed MW | 33kDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.01% thiomersal, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | U-87MG, Mouse brain, Rat brain |
| Cellular location | fibrillar center, nucleolus, nucleoplasm, nucleus |
Research Area
EN2 Rabbit pAb images
Western blot analysis of extracts of various cell lines, using EN2 antibody (A17480) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.
* For research use only. Not for therapeutic or diagnostic purposes.
